PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010528537.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 228aa    MW: 26006.3 Da    PI: 8.7167
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010528537.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.61.6e-142771248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g+  +eE +l ++++k+lG++ W++Ia +++ gRt++++k++w+++l
   XP_010528537.1 27 GKLVPEEVDLVIRLHKLLGNR-WSLIAGRLP-GRTANDVKNYWNSHL 71
                     66669****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.67120IPR017877Myb-like domain
SuperFamilySSF466899.19E-19676IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.2E-5619IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-222074IPR009057Homeodomain-like
PROSITE profilePS5129424.832175IPR017930Myb domain
SMARTSM007176.1E-142573IPR001005SANT/Myb domain
PfamPF002493.7E-132671IPR001005SANT/Myb domain
CDDcd001671.65E-103171No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MASGLNRCRK SCRLRWLNYL KPSIKRGKLV PEEVDLVIRL HKLLGNRWSL IAGRLPGRTA  60
NDVKNYWNSH LRKKQNPSSN CKIKPTCRKQ INVRSLTEPV QKIDVIKPRP RSFYDNSQHR  120
FLNAPPQITF TGGGKDEDFN ENNNSDDNYK NDDIPRGNKT CDRDYEFGTM KSIVNDEGRE  180
IMWWESLLEE SEGAAAAEED ENITGAAESS PVNLAAATFD VGLWNLLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-1677440107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010528537.11e-170PREDICTED: transcription factor MYB113-like isoform X2
SwissprotQ9FNV99e-55MY113_ARATH; Transcription factor MYB113
TrEMBLE5D8F51e-58E5D8F5_BRAOB; MYB2
STRINGBra004162.1-P5e-56(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-51myb domain protein 113